PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | WALNUT_00013693-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 177aa MW: 20366.9 Da PI: 7.7444 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.1 | 3.9e-10 | 110 | 144 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp++ee+ +L++ +gL+++q+++WF N+R ++ WALNUT_00013693-RA 110 RWPYPTEEEKSRLSEVTGLDQKQISNWFINQRKRH 144 469*****************************985 PP | |||||||
2 | ELK | 27.9 | 5.4e-10 | 64 | 85 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK+ LlrKYsgyL++L +EF+ WALNUT_00013693-RA 64 ELKEKLLRKYSGYLSNLMKEFL 85 9********************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 4.5E-5 | 64 | 85 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.493 | 64 | 84 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.1E-7 | 64 | 85 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.6 | 84 | 147 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.13E-20 | 86 | 159 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.9E-13 | 86 | 151 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-27 | 89 | 149 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.54E-12 | 96 | 148 | No hit | No description |
Pfam | PF05920 | 3.4E-17 | 104 | 143 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 122 | 145 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MLFVWISKPF SASHGTFLSF FRSFYVSLDE ATGTSGEELS YGEVDAAALE NQELSSTGPS 60 GDNELKEKLL RKYSGYLSNL MKEFLKKRKK GKLPKDATLA LMDWWNTHYR WPYPTEEEKS 120 RLSEVTGLDQ KQISNWFINQ RKRHWKPSED MRFALMDDVS SSAGGPIYFD PGDRTGR |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 85 | 89 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021663046.1 | 4e-70 | homeobox protein knotted-1-like 1 isoform X1 | ||||
Refseq | XP_021663047.1 | 4e-70 | homeobox protein knotted-1-like 1 isoform X1 | ||||
Swissprot | A2Y007 | 1e-51 | KNOSA_ORYSI; Homeobox protein knotted-1-like 10 | ||||
Swissprot | Q7GDL5 | 1e-51 | KNOSA_ORYSJ; Homeobox protein knotted-1-like 10 | ||||
TrEMBL | A0A2R6R152 | 2e-69 | A0A2R6R152_ACTCH; Homeobox protein knotted-1-like | ||||
STRING | XP_010024132.1 | 1e-67 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 5e-37 | KNOTTED-like from Arabidopsis thaliana |