PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

HSF

Protein Properties

Length: 88aa MW: 10000.3 Da PI: 4.4086

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00011112-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	58.9	1.4e-18	16	77	1	62
HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 +Fl+kl +++++e+++++sws+++n+fvv+++ efa k+Lpk+Fkh+n+aSF+ L ++ F WALNUT_00011112-RA 16 SFLRKLDAMVDESETDSVVSWSDSNNNFVVWNPYEFAAKLLPKHFKHKNLASFTLTLVIFIF 77 59***************************************************988877665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	3.4E-20	8	78	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	3.9E-8	13	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	8.71E-18	14	84	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	3.1E-15	17	77	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	5.1E-9	17	40	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	5.1E-9	55	67	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MVDVNDAGSS TDTLPSFLRK LDAMVDESET DSVVSWSDSN NNFVVWNPYE FAAKLLPKHF 60 KHKNLASFTL TLVIFIFFVL TSFSNYLD

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018829016.1	2e-33	PREDICTED: heat stress transcription factor A-1b-like
Refseq	XP_018829017.1	2e-33	PREDICTED: heat stress transcription factor A-1b-like
Swissprot	Q7XRX3	2e-17	HFB2A_ORYSJ; Heat stress transcription factor B-2a
TrEMBL	A0A2I4FBJ6	4e-32	A0A2I4FBJ6_JUGRE; heat stress transcription factor A-1b-like
STRING	Aquca_005_00532.1	3e-18	(Aquilegia coerulea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G32330.1	2e-07	heat shock transcription factor A1D

Publications ? help Back to Top
Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634]