PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Cis-element |

Regulation |

Orthologous Group |

Basic Information? help Back to Top

TF ID

Vradi10g06620.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

LBD

Protein Properties

Length: 61aa MW: 6436.25 Da PI: 7.3561

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi10g06620.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	44.4	4.8e-14	1	40	61	100
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal+++e Vradi10g06620.1 1 MVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLALAQAE 40 69**********************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	9.599	1	41	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.5E-11	1	38	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MVYEANARVR DPVYGCVGAI SSLQQQIDVL QTQLALAQAE VAHLRVRQNS GGAGGDRAPW 60 *

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi10g06620.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015038	2e-65	AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014518102.1	1e-26	LOB domain-containing protein 4
Refseq	XP_017435904.1	2e-26	PREDICTED: LOB domain-containing protein 4-like
Refseq	XP_027931736.1	1e-26	LOB domain-containing protein 4-like
Swissprot	Q9SHE9	5e-19	LBD4_ARATH; LOB domain-containing protein 4
TrEMBL	A0A0L9VDQ5	3e-25	A0A0L9VDQ5_PHAAN; Uncharacterized protein
TrEMBL	A0A0S3S4E4	4e-25	A0A0S3S4E4_PHAAN; Uncharacterized protein
TrEMBL	A0A1S3VIR3	3e-25	A0A1S3VIR3_VIGRR; LOB domain-containing protein 4
TrEMBL	A0A371I1T7	5e-25	A0A371I1T7_MUCPR; LOB domain-containing protein 4 (Fragment)
STRING	Lus10040638	9e-26	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1334	34	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G31320.1	2e-21	LOB domain-containing protein 4