PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi07g17810.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 164aa MW: 18544.8 Da PI: 9.6583 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.9 | 5.9e-15 | 55 | 114 | 4 | 63 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +++ +r+ +NRe+ArrsR RKk++ie L+ v+ L++ N++L +++ l + ++ +++ Vradi07g17810.1 55 DRKKKRMFSNRESARRSRMRKKQQIEVLQYHVDHLQTLNHQLSQKIIYLLECNQQIHQQN 114 7899****************************************9988888888877776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.5E-13 | 52 | 116 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.254 | 54 | 117 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.6E-13 | 55 | 114 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.0E-12 | 56 | 114 | No hit | No description |
SuperFamily | SSF57959 | 2.31E-11 | 56 | 107 | No hit | No description |
CDD | cd14702 | 6.54E-13 | 57 | 105 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 59 | 74 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
METAEGHFPF FCSQLHLPSN THDPIQIPLH KPSPNTSSNS NNNNNSDEAK ALLDDRKKKR 60 MFSNRESARR SRMRKKQQIE VLQYHVDHLQ TLNHQLSQKI IYLLECNQQI HQQNSQLKEK 120 VSSLQVVLSD LLVPAAGAEQ PHHIPNGFPA EPSSTRPIAS SRT* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi07g17810.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014508438.1 | 1e-116 | basic leucine zipper 43 isoform X1 | ||||
Refseq | XP_022639364.1 | 1e-116 | basic leucine zipper 43 isoform X1 | ||||
Refseq | XP_022639365.1 | 1e-116 | basic leucine zipper 43 isoform X1 | ||||
Refseq | XP_022639366.1 | 1e-116 | basic leucine zipper 43 isoform X1 | ||||
TrEMBL | A0A1S3UQT0 | 1e-115 | A0A1S3UQT0_VIGRR; basic leucine zipper 43 isoform X1 | ||||
STRING | XP_007155196.1 | 2e-82 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13044 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60830.1 | 3e-24 | basic leucine-zipper 70 |