PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi07g16480.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 112aa MW: 12718.7 Da PI: 6.7677 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 57.2 | 4.6e-18 | 5 | 47 | 2 | 44 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-T CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCq 44 Cqv++C+adlseak+yhrrhkvCe h+k +v ++gl+qr q Vradi07g16480.1 5 CQVDNCDADLSEAKQYHRRHKVCEYHAKVHSVHMAGLQQRLQQ 47 ****************************************865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 12.973 | 2 | 75 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 8.2E-19 | 2 | 47 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 7.46E-17 | 3 | 47 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.2E-13 | 5 | 45 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MPPSCQVDNC DADLSEAKQY HRRHKVCEYH AKVHSVHMAG LQQRLQQLTF LEKFCFSDSM 60 SCLNLMNQKG VVEHVWLVIT RGDAKMQLTI VESNFFVVTM NINSLEASIC D* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-13 | 5 | 47 | 11 | 53 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi07g16480.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 2e-78 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007159344.1 | 1e-50 | hypothetical protein PHAVU_002G230300g | ||||
TrEMBL | V7CPQ3 | 3e-49 | V7CPQ3_PHAVU; Uncharacterized protein | ||||
STRING | XP_007159344.1 | 5e-50 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF22691 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G02065.2 | 3e-15 | squamosa promoter binding protein-like 8 |