PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi07g05140.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 198aa MW: 22164.1 Da PI: 10.867 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.5 | 3.1e-13 | 60 | 104 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + + G+g+W+ I+r + k+Rt+ q+ s+ qky Vradi07g05140.1 60 PWTEEEHRQFLLGLQNVGKGDWRGISRNFVKTRTPTQVASHAQKY 104 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.439 | 52 | 109 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.48E-17 | 54 | 108 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.6E-17 | 56 | 107 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 2.5E-8 | 57 | 107 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-10 | 60 | 104 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.92E-9 | 60 | 105 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.2E-11 | 60 | 104 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MLFGVRLTVP NNNPTVFRKS ASMNNLSPNS ESPPPHHPNA GYASDDVVHL CRRTRKRGIP 60 WTEEEHRQFL LGLQNVGKGD WRGISRNFVK TRTPTQVASH AQKYFLRRHT HNRRRRRSSL 120 FDITTDSVKE EEQAVPSARS KPVLPPPPSL KMAELDLNGR SLSLKLRLPE PEEPSPVTFE 180 VVSSGNLSGD VDMISVA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi07g05140.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 1e-110 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014508244.1 | 1e-143 | transcription factor MYB1R1 | ||||
Swissprot | Q7XC57 | 2e-43 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A1S3UQN3 | 1e-142 | A0A1S3UQN3_VIGRR; transcription factor MYB1R1 | ||||
STRING | XP_007153882.1 | 1e-121 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5338 | 33 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G70000.2 | 6e-43 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|