![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi06g07670.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 110aa MW: 12094.7 Da PI: 8.9322 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 50.2 | 5.1e-16 | 21 | 57 | 23 | 60 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 YY+Ct+++Cp+kkkvers d++++ei Y+++Hnh+k Vradi06g07670.1 21 CYYKCTYPSCPTKKKVERSL-DGQITEIAYKSSHNHPK 57 6*******************.***************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 2.9E-7 | 14 | 57 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.53E-11 | 19 | 58 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 2.7E-12 | 20 | 59 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-10 | 20 | 56 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 10.739 | 22 | 58 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MSKKLLCHLS VLFLKASSIT CYYKCTYPSC PTKKKVERSL DGQITEIAYK SSHNHPKPQA 60 NKRNSLSASS LAINSVNNEI TQATHHMDSV ATLEKSSISM EDDDFGQSK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi06g07670.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 1e-121 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014489595.1 | 2e-52 | WRKY transcription factor WRKY24 | ||||
Swissprot | Q6B6R4 | 2e-21 | WRK24_ORYSI; WRKY transcription factor WRKY24 | ||||
TrEMBL | A0A1S3T755 | 4e-51 | A0A1S3T755_VIGRR; WRKY transcription factor WRKY24 | ||||
STRING | XP_007146842.1 | 1e-39 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38470.1 | 3e-20 | WRKY DNA-binding protein 33 |
Publications ? help Back to Top | |||
---|---|---|---|
|