![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi04g07130.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 184aa MW: 20953.7 Da PI: 9.4174 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.8 | 9.4e-33 | 104 | 162 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+ Vradi04g07130.1 104 LDDGYRWRKYGQKAVKNSTYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 162 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.9E-33 | 91 | 162 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-28 | 97 | 163 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.908 | 99 | 164 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-37 | 104 | 163 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.8E-26 | 105 | 162 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MESHDPPPQN NPFLFNPLEP QEQGLCDFDS WGNLFSAQNS LLLLNGGKET IQRASSSSSS 60 LMAQNKVVCE EEKGNKEKRK GVRVKKTTRV PRFAFQTRSA DDVLDDGYRW RKYGQKAVKN 120 STYPRSYYRC THHTCNVKKQ VQRLSKDTSI VVTTYEGIHN HPCEKLMETL TPLLKQIEFL 180 ASL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-25 | 94 | 161 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-25 | 94 | 161 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi04g07130.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015037 | 1e-165 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022635253.1 | 1e-137 | probable WRKY transcription factor 43 | ||||
Swissprot | Q9FFS3 | 3e-56 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A3Q0EU52 | 1e-136 | A0A3Q0EU52_VIGRR; probable WRKY transcription factor 43 | ||||
STRING | GLYMA18G47350.1 | 1e-100 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 2e-56 | WRKY DNA-binding protein 24 |