PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

LBD

Protein Properties

Length: 119aa MW: 13331.1 Da PI: 4.1055

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi02g13200.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	58.6	1.8e-18	3	58	45	100
DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 ++++lp e+r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la++++e Vradi02g13200.1 3 MVQELPIEQRADAVSSLVYEAHARVRDPVYGCVGAISYLQNQVSELQMQLAVAQAE 58 899*************************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	11.959	1	59	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	7.2E-17	3	56	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 119 aa Download sequence Send to blast
MLMVQELPIE QRADAVSSLV YEAHARVRDP VYGCVGAISY LQNQVSELQM QLAVAQAEIL 60 CIQMQQEPVM PNPEMENPDH KSYLLQNELP QFLNYASSSN VIYDAVSRDN IYGHDMVS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-18	3	60	55	112	LOB family transfactor Ramosa2.1
5ly0_B	2e-18	3	60	55	112	LOB family transfactor Ramosa2.1
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi02g13200.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015037	0.0	AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014493648.2	4e-79	LOB domain-containing protein 12 isoform X1
Swissprot	Q8LBW3	1e-35	LBD12_ARATH; LOB domain-containing protein 12
TrEMBL	A0A1S3TIP2	9e-78	A0A1S3TIP2_VIGRR; LOB domain-containing protein 12 isoform X1
STRING	XP_007163576.1	5e-75	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1664	34	97

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30130.1	2e-33	LBD family protein

Publications ? help Back to Top
Penfield S, et al. Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1. Plant Cell, 2004. 16(10): p. 2705-18 [PMID:15367715]