PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vradi0270s00050.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WRKY

Protein Properties

Length: 130aa MW: 14426.2 Da PI: 8.3278

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi0270s00050.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	50.6	3.8e-16	21	57	23	60
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 YY+Ct+++Cp+kkkvers d++++ei+Y+++Hnh+k Vradi0270s00050.1 21 CYYKCTYPSCPTKKKVERSL-DGQITEIVYKSSHNHPK 57 6*****************.*************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00774	1.7E-7	14	57	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	1.8E-12	20	59	IPR003657	WRKY domain
Pfam	PF03106	1.0E-10	20	56	IPR003657	WRKY domain
SuperFamily	SSF118290	2.62E-11	20	58	IPR003657	WRKY domain
PROSITE profile	PS50811	10.739	22	58	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MSKKLLCHLS VLFLKASSIT CYYKCTYPSC PTKKKVERSL DGQITEIVYK SSHNHPKPQA 60 NKRNSLSASS LAINNVNNEI TQATHHMDSV ATPEKSSISM EDDDFGKSKS GGDEFDNDEP 120 DAKKMENRR*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250\|UniProtKB:Q6IEQ7, ECO:0000250\|UniProtKB:Q6QHD1}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi0270s00050.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250\|UniProtKB:Q6IEQ7, ECO:0000269\|PubMed:16919842, ECO:0000269\|PubMed:25110688}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015038	1e-148	AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014489595.1	2e-64	WRKY transcription factor WRKY24
Swissprot	Q6B6R4	1e-31	WRK24_ORYSI; WRKY transcription factor WRKY24
TrEMBL	A0A1S3T755	4e-63	A0A1S3T755_VIGRR; WRKY transcription factor WRKY24
STRING	XP_007146842.1	5e-51	(Phaseolus vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G38470.1	2e-20	WRKY DNA-binding protein 33

Publications ? help Back to Top
Basu S,Roychoudhury A Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance. Biomed Res Int, 2014. 2014: p. 706890 [PMID:25110688]