![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi01g12230.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 215aa MW: 23696.4 Da PI: 5.6535 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 26.2 | 1.7e-08 | 66 | 116 | 13 | 63 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 NR +A rs +RK ++ eLe+kv++L++e + L +l +l+ l++e+ Vradi01g12230.1 66 NRQSAARSKERKIRYTSELERKVQTLQTEATNLSAQLTMLQRDTTDLTAEN 116 ****************************************99999998887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.8E-10 | 56 | 118 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14703 | 9.58E-19 | 63 | 108 | No hit | No description |
SuperFamily | SSF57959 | 9.85E-10 | 63 | 110 | No hit | No description |
Pfam | PF00170 | 1.9E-6 | 65 | 116 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.0E-9 | 65 | 113 | No hit | No description |
PROSITE profile | PS50217 | 9.519 | 66 | 119 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MPERGSHHRR SHSDTSFRFA ANFDDLLLFD ASDLDISTLP SPLPLPSPGA SGAVPIAVDS 60 DEILANRQSA ARSKERKIRY TSELERKVQT LQTEATNLSA QLTMLQRDTT DLTAENKELK 120 LRLEALEQEA QLREDLNEAL KEELQRLRAQ STRLGAIAGN PSFGGIFNQL ASQLAMQQLS 180 NSAPQQAQHQ AQVGMPPPPS GQNHPNFMDF NQQK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269|PubMed:11432846, ECO:0000269|PubMed:12124400, ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315, ECO:0000269|PubMed:17947581, ECO:0000269|PubMed:19820165, ECO:0000269|PubMed:20547563}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi01g12230.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269|PubMed:15108305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 1e-121 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020233663.1 | 2e-99 | transcription factor VIP1 | ||||
Swissprot | Q9MA75 | 3e-39 | VIP1_ARATH; Transcription factor VIP1 | ||||
TrEMBL | A0A151S234 | 4e-98 | A0A151S234_CAJCA; Transcription factor RF2b | ||||
STRING | GLYMA02G09140.1 | 1e-89 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5214 | 34 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31370.5 | 4e-27 | bZIP family protein |