PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0153s00450.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 124aa MW: 13605.9 Da PI: 8.0324 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 134.5 | 4.1e-42 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +Ca+Ck+lrr+C++dC++apyfp+++ kfa+vhk+FG sn++k+lk++p e+r da++slvyeA+ar+ +PvyG+vg+i+kl+ q+++l+ Vradi0153s00450.1 7 PCASCKLLRRRCSPDCIFAPYFPSNDLCKFAIVHKVFGCSNITKILKNVPVEQRGDAVRSLVYEANARIINPVYGCVGIISKLETQVSELQM 98 7******************************************************************************************* PP DUF260 93 elallkee 100 +la+++ee Vradi0153s00450.1 99 QLAVVEEE 106 ***99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.134 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.6E-42 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MGGTSSPCAS CKLLRRRCSP DCIFAPYFPS NDLCKFAIVH KVFGCSNITK ILKNVPVEQR 60 GDAVRSLVYE ANARIINPVY GCVGIISKLE TQVSELQMQL AVVEEEILSI KMQQEFIFTN 120 GST* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-41 | 3 | 108 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-41 | 3 | 108 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0153s00450.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 1e-109 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014489817.1 | 6e-87 | LOB domain-containing protein 12 | ||||
Swissprot | Q8LBW3 | 9e-56 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | A0A1S3T7T4 | 1e-85 | A0A1S3T7T4_VIGRR; LOB domain-containing protein 12 | ||||
STRING | XP_007142160.1 | 1e-72 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1664 | 34 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 4e-58 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|