PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vradi0043s00750.1

Organism

Vigna radiata

Taxonomic ID

157791

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WRKY

Protein Properties

Length: 87aa MW: 10013 Da PI: 9.7572

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vradi0043s00750.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	92.1	4.1e-29	1	59	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K+vk++ +pr+YY+C+ agC+vkk+ver+++d ++v +tY g Hnh+ Vradi0043s00750.1 1 MDDGYKWRKYGKKTVKNNSNPRNYYKCSGAGCSVKKRVERDRNDSNYVLTTYVGVHNHH 59 69********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.6E-27	1	61	IPR003657	WRKY domain
PROSITE profile	PS50811	28.633	1	61	IPR003657	WRKY domain
SMART	SM00774	1.9E-29	1	60	IPR003657	WRKY domain
SuperFamily	SSF118290	7.98E-26	1	61	IPR003657	WRKY domain
Pfam	PF03106	7.7E-23	2	59	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MDDGYKWRKY GKKTVKNNSN PRNYYKCSGA GCSVKKRVER DRNDSNYVLT TYVGVHNHHT 60 PSSYYTQMPL LHSDDWNLHP SATQNS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-21	1	62	17	78	Probable WRKY transcription factor 4
2lex_A	4e-21	1	62	17	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vradi0043s00750.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015035	2e-99	AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014489962.1	1e-59	probable WRKY transcription factor 51
Swissprot	Q93WU9	3e-32	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	A0A1S3T885	3e-58	A0A1S3T885_VIGRR; probable WRKY transcription factor 51
STRING	XP_007137588.1	1e-51	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1120	34	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	1e-34	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]