![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vradi0043s00400.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 154aa MW: 17953.5 Da PI: 9.998 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.6 | 1.1e-32 | 76 | 134 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+ Vradi0043s00400.1 76 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 134 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.9E-34 | 61 | 134 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.18E-29 | 68 | 135 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.356 | 71 | 136 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.8E-37 | 76 | 135 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.5E-25 | 77 | 133 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MEFASFIGQT VPLSFEANRK VRAWEEVTDC LMSKRMGGGD NHHLGVSAMK MKKMKARRKV 60 REPRFCFKTM SDVDVLDDGY KWRKYGQKVV KNTQHPRSYY RCTQDNCRVK KRVERLAEDP 120 RMVITTYEGR HVHSPSNELE DSQSPSELSS FLW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-27 | 67 | 133 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-27 | 67 | 133 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vradi0043s00400.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU019581 | 1e-166 | EU019581.1 Glycine max WRKY45 (WRKY45) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014489951.1 | 3e-96 | probable WRKY transcription factor 13 | ||||
Refseq | XP_017407180.1 | 3e-96 | PREDICTED: probable WRKY transcription factor 13 isoform X1 | ||||
Swissprot | Q9SVB7 | 1e-60 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | A0A0L9T937 | 6e-95 | A0A0L9T937_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3REQ0 | 6e-95 | A0A0S3REQ0_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A1S3T856 | 8e-95 | A0A1S3T856_VIGRR; probable WRKY transcription factor 13 | ||||
STRING | GLYMA04G39621.1 | 1e-81 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4079 | 33 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 2e-54 | WRKY DNA-binding protein 13 |