PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang2002s00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 97aa MW: 10991.2 Da PI: 10.2303 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 23.8 | 7.4e-08 | 3 | 40 | 24 | 57 |
S--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 24 ypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +p ++e++ + +l ++ +++V +WFqNr+ + k+ Vang2002s00010.1 3 NPPRDEIRNIWVQLqeygQVGDANVLYWFQNRKSRSKN 40 788999999999999999*****************995 PP | |||||||
2 | Wus_type_Homeobox | 61.9 | 1.4e-20 | 1 | 41 | 24 | 64 |
Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 +++P+++ei++i +L+eyG+++d+NV yWFQNrk+R+++k Vang2002s00010.1 1 MVNPPRDEIRNIWVQLQEYGQVGDANVLYWFQNRKSRSKNK 41 79*************************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00046 | 2.5E-5 | 3 | 39 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.7E-6 | 3 | 44 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MVNPPRDEIR NIWVQLQEYG QVGDANVLYW FQNRKSRSKN KLRHIQNSKN HNTETQPNSI 60 SLSQIIPPST SSSSSDKSSS KELVHPNAIS LNQNYL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang2002s00010.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 1e-162 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014506392.1 | 9e-42 | WUSCHEL-related homeobox 9-like | ||||
Refseq | XP_022640191.1 | 9e-42 | WUSCHEL-related homeobox 9-like | ||||
Swissprot | Q6X7J4 | 1e-20 | WOX9_ARATH; WUSCHEL-related homeobox 9 | ||||
TrEMBL | A0A0L9TLW3 | 6e-41 | A0A0L9TLW3_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A1S3UK30 | 2e-40 | A0A1S3UK30_VIGRR; WUSCHEL-related homeobox 9-like | ||||
STRING | XP_007153888.1 | 6e-37 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5898 | 31 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33880.1 | 2e-22 | homeobox-3 |
Publications ? help Back to Top | |||
---|---|---|---|
|