![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang1896s00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 132aa MW: 15113.8 Da PI: 9.976 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 51.2 | 2.2e-16 | 15 | 75 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++R+++++eq+++Le+ F++ +p ++e++ + +l ++ +++V +WFqNr+ + k+ Vang1896s00010.1 15 KSRWNPKPEQIRILEAIFNSgMVNPPRDEIRNIWVQLqeygQVGDANVLYWFQNRKSRSKN 75 89*****************99*************************************995 PP | |||||||
2 | Wus_type_Homeobox | 106.5 | 1.6e-34 | 14 | 76 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 +++RW+P+peQi+iLe++++sG+++P+++ei++i +L+eyG+++d+NV yWFQNrk+R+++k Vang1896s00010.1 14 PKSRWNPKPEQIRILEAIFNSGMVNPPRDEIRNIWVQLQEYGQVGDANVLYWFQNRKSRSKNK 76 689**********************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-7 | 10 | 79 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.42E-12 | 11 | 79 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 10.074 | 11 | 76 | IPR001356 | Homeobox domain |
SMART | SM00389 | 6.7E-5 | 13 | 80 | IPR001356 | Homeobox domain |
CDD | cd00086 | 5.44E-5 | 14 | 76 | No hit | No description |
Pfam | PF00046 | 5.6E-14 | 15 | 74 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MDHYKGNEEK TPEPKSRWNP KPEQIRILEA IFNSGMVNPP RDEIRNIWVQ LQEYGQVGDA 60 NVLYWFQNRK SRSKNKLRHI QNSKNHNTET QPNSISLSQI IPPSTSSSSS DKSSSKELVH 120 PNAISLNQNY L* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang1896s00010.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 0.0 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014506392.1 | 4e-65 | WUSCHEL-related homeobox 9-like | ||||
Refseq | XP_022640191.1 | 4e-65 | WUSCHEL-related homeobox 9-like | ||||
Swissprot | Q6X7J4 | 2e-39 | WOX9_ARATH; WUSCHEL-related homeobox 9 | ||||
TrEMBL | A0A1S3UK30 | 8e-64 | A0A1S3UK30_VIGRR; WUSCHEL-related homeobox 9-like | ||||
STRING | XP_007153888.1 | 4e-59 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5898 | 31 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33880.1 | 4e-41 | homeobox-3 |
Publications ? help Back to Top | |||
---|---|---|---|
|