![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang10g05410.1 | ||||||||
Common Name | LR48_Vigan11g091400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 235aa MW: 26055.5 Da PI: 9.9314 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.3 | 2e-14 | 94 | 138 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky Vang10g05410.1 94 PWTEEEHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 138 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.60.10 | 4.9E-4 | 3 | 20 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 18.527 | 87 | 143 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.89E-18 | 88 | 143 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 5.0E-18 | 90 | 141 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.5E-11 | 91 | 141 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.5E-12 | 91 | 137 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.82E-10 | 94 | 139 | No hit | No description |
Pfam | PF00249 | 7.8E-12 | 94 | 138 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MGRKCSHCGV IGHNSRTCTS LRGSSFVGLR LFGVQLDTCV TIKKSFSMDS LPSSSSSSFS 60 SSRITIDENS DRTSFGYLSD GLIGRVQERK KGVPWTEEEH RIFLVGLEKL GKGDWRGISR 120 NFVTTRTPTQ VASHAQKYFL RLATIDKKKR RSSLFDVVGS NNVGGCNSVS GYHKKDDSKC 180 EVKNSDATLS LLGRITYFQQ ESKSDYKKQE KLENCPHQVP NLELTLRSCL GQLV* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 146 | 150 | KKKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00565 | DAP | Transfer from AT5G56840 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang10g05410.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT031194 | 0.0 | KT031194.1 Glycine max clone HN_CCL_90 MYB/HD-like transcription factor (Glyma08g03330.1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017441883.1 | 1e-172 | PREDICTED: transcription factor MYB1R1-like isoform X2 | ||||
Swissprot | Q7XC57 | 2e-49 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A0L9VS24 | 1e-171 | A0A0L9VS24_PHAAN; Uncharacterized protein | ||||
STRING | XP_007160238.1 | 1e-126 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3213 | 32 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56840.1 | 2e-54 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|