PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang08g06450.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 92aa MW: 10950.2 Da PI: 8.6007 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 106.3 | 1.6e-33 | 17 | 75 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+ Vang08g06450.4 17 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 75 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.3E-35 | 2 | 75 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.27E-29 | 9 | 75 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.585 | 12 | 74 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.3E-38 | 17 | 76 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.7E-26 | 18 | 74 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
LREPRFCFQT RSDVDVLDDG YKWRKYGQKV VKNSLHPRSY YRCTHNNCRV KKRVERLSED 60 CRMVITTYEG RHNHSPCDDS NSSEHECFTS F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-28 | 8 | 74 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-28 | 8 | 74 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00618 | PBM | Transfer from AT2G44745 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang08g06450.4 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015042 | 8e-87 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003521060.1 | 3e-64 | probable WRKY transcription factor 12 | ||||
Refseq | XP_028225005.1 | 3e-64 | probable WRKY transcription factor 12 | ||||
Swissprot | Q93WY4 | 4e-58 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | A0A0B2PRL9 | 9e-63 | A0A0B2PRL9_GLYSO; Putative WRKY transcription factor 12 | ||||
TrEMBL | A0A445LA92 | 7e-63 | A0A445LA92_GLYSO; Putative WRKY transcription factor 12 | ||||
TrEMBL | I1JMP1 | 7e-63 | I1JMP1_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA03G25770.1 | 1e-63 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44745.1 | 2e-60 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|