PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang08g06450.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 143aa MW: 16848.8 Da PI: 8.5904 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.7 | 5.1e-33 | 68 | 126 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+ Vang08g06450.3 68 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 126 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.7E-34 | 53 | 126 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.58E-29 | 60 | 126 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.585 | 63 | 125 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.3E-38 | 68 | 127 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.2E-25 | 69 | 125 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MEGERGVNPS YDLQVSFSNT PQAIHEMGFV QFEENQVLSF SEKNKVKVRR KLREPRFCFQ 60 TRSDVDVLDD GYKWRKYGQK VVKNSLHPRS YYRCTHNNCR VKKRVERLSE DCRMVITTYE 120 GRHNHSPCDD SNSSEHECFT SF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 59 | 125 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 59 | 125 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 46 | 52 | KVRRKLR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00618 | PBM | Transfer from AT2G44745 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang08g06450.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021612141.1 | 4e-79 | probable WRKY transcription factor 12 isoform X2 | ||||
Swissprot | Q93WY4 | 2e-64 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | A0A151RGA7 | 1e-70 | A0A151RGA7_CAJCA; Putative WRKY transcription factor 12 | ||||
TrEMBL | A0A445LA92 | 3e-70 | A0A445LA92_GLYSO; Putative WRKY transcription factor 12 | ||||
TrEMBL | I1JMP1 | 3e-70 | I1JMP1_SOYBN; Uncharacterized protein | ||||
STRING | evm.model.supercontig_22.34 | 2e-75 | (Carica papaya) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44745.1 | 1e-66 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|