PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang08g06450.3

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

WRKY

Protein Properties

Length: 143aa MW: 16848.8 Da PI: 8.5904

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang08g06450.3	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.7	5.1e-33	68	126	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+ Vang08g06450.3 68 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 126 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.7E-34	53	126	IPR003657	WRKY domain
SuperFamily	SSF118290	4.58E-29	60	126	IPR003657	WRKY domain
PROSITE profile	PS50811	29.585	63	125	IPR003657	WRKY domain
SMART	SM00774	6.3E-38	68	127	IPR003657	WRKY domain
Pfam	PF03106	1.2E-25	69	125	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 143 aa Download sequence Send to blast
MEGERGVNPS YDLQVSFSNT PQAIHEMGFV QFEENQVLSF SEKNKVKVRR KLREPRFCFQ 60 TRSDVDVLDD GYKWRKYGQK VVKNSLHPRS YYRCTHNNCR VKKRVERLSE DCRMVITTYE 120 GRHNHSPCDD SNSSEHECFT SF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-27	59	125	8	74	Probable WRKY transcription factor 4
2lex_A	2e-27	59	125	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	46	52	KVRRKLR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00618	PBM	Transfer from AT2G44745	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang08g06450.3

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021612141.1	4e-79	probable WRKY transcription factor 12 isoform X2
Swissprot	Q93WY4	2e-64	WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBL	A0A151RGA7	1e-70	A0A151RGA7_CAJCA; Putative WRKY transcription factor 12
TrEMBL	A0A445LA92	3e-70	A0A445LA92_GLYSO; Putative WRKY transcription factor 12
TrEMBL	I1JMP1	3e-70	I1JMP1_SOYBN; Uncharacterized protein
STRING	evm.model.supercontig_22.34	2e-75	(Carica papaya)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G44745.1	1e-66	WRKY family protein

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Yang L, et al. PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa. Sci Rep, 2016. 6: p. 18643 [PMID:26819184] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Han Y, et al. WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 149-159 [PMID:30617455]