|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Vang08g00620.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
Family |
Trihelix |
Protein Properties |
Length: 59aa MW: 7209.31 Da PI: 10.3613 |
Description |
Trihelix family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Vang08g00620.1 | genome | SNU | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | trihelix | 60.3 | 4.7e-19 | 2 | 54 | 33 | 86 |
trihelix 33 evskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
e+s+ mr+ g++r++k+ kekwen+nk++k++ke++k+r e+s+tcpyf+q++
Vang08g00620.1 2 EISSLMRKLGYNRNAKRSKEKWENINKYFKEVKESNKRR-LEDSKTCPYFQQMD 54
89***********************************98.68889********8 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AP015042 | 4e-94 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. |