PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Vang08g00620.1

Organism

Vigna angularis

Taxonomic ID

3914

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

Trihelix

Protein Properties

Length: 59aa MW: 7209.31 Da PI: 10.3613

Description

Trihelix family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang08g00620.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	trihelix	60.3	4.7e-19	2	54	33	86
trihelix 33 evskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 e+s+ mr+ g++r++k+ kekwen+nk++k++ke++k+r e+s+tcpyf+q++ Vang08g00620.1 2 EISSLMRKLGYNRNAKRSKEKWENINKYFKEVKESNKRR-LEDSKTCPYFQQMD 54 89*********************************98.68889******8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF13837	1.8E-11	2	55	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MEISSLMRKL GYNRNAKRSK EKWENINKYF KEVKESNKRR LEDSKTCPYF QQMDVLYR*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269\|PubMed:19717615, ECO:0000269\|PubMed:21169508}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang08g00620.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by water stress. {ECO:0000269\|PubMed:21169508}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015042	4e-94	AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027936532.1	2e-27	trihelix transcription factor GT-2-like
Swissprot	Q9C882	4e-24	GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBL	A0A392P826	8e-27	A0A392P826_9FABA; Trihelix transcription factor GT-2-like
TrEMBL	A0A4D6N5G7	4e-26	A0A4D6N5G7_VIGUN; Uncharacterized protein
STRING	XP_002532429.1	2e-26	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF373	34	181

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G76880.1	3e-28	Trihelix family protein

Publications ? help Back to Top
Caro E,Desvoyes B,Gutierrez C GTL1 keeps cell growth and nuclear ploidy under control. EMBO J., 2012. 31(24): p. 4483-5 [PMID:23188085] Zheng X, et al. The Wheat GT Factor TaGT2L1D Negatively Regulates Drought Tolerance and Plant Development. Sci Rep, 2016. 6: p. 27042 [PMID:27245096] Shibata M, et al. GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis. Development, 2018. [PMID:29439132]