PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang07g02980.1 | ||||||||
Common Name | LR48_Vigan06g023700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 175aa MW: 20349 Da PI: 10.6219 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.2 | 2.3e-10 | 75 | 134 | 5 | 64 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 ++ rr+++NR +ArrsR RK+ +e+L++ + + eN++L + + l ++ +l++e+e Vang07g02980.1 75 RKRRRMISNRDSARRSRMRKQRHLENLRNQMNLFRVENRELNNGFQFLLHHCNRLRTENE 134 6789************************************************99999885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-10 | 71 | 135 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.025 | 73 | 136 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.0E-8 | 74 | 134 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.39E-10 | 75 | 127 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 3.4E-8 | 75 | 147 | No hit | No description |
CDD | cd14702 | 9.92E-16 | 76 | 127 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 78 | 93 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MLSHLTSSDS LLGNAFPAFD YALAPWDGLD FLAFNPTSPN PVTSSSASDD PKTTPADQKP 60 PSDQSNRVVS FTEERKRRRM ISNRDSARRS RMRKQRHLEN LRNQMNLFRV ENRELNNGFQ 120 FLLHHCNRLR TENEWLRSER TMLRQKLADI NQILLFRQLQ PFSTAWPCNI VMTE* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 74 | 78 | RKRRR |
2 | 87 | 94 | RRSRMRKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang07g02980.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015043 | 0.0 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017427037.1 | 1e-126 | PREDICTED: bZIP transcription factor 53-like | ||||
TrEMBL | A0A0L9UQE1 | 1e-124 | A0A0L9UQE1_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3T507 | 1e-124 | A0A0S3T507_PHAAN; Uncharacterized protein | ||||
STRING | XP_007156692.1 | 4e-94 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5435 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 9e-28 | basic leucine-zipper 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|