PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g16250.1
Organism
Vigna angularis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 96aa    MW: 10711.3 Da    PI: 10.0538
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g16250.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT eEde+l+++++  G g+W++ ++  g+ R++k+c++rw +yl
   Vang06g16250.1 14 KGRWTSEEDEILAKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129420.753965IPR017930Myb domain
SMARTSM007171.9E-111363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-201588IPR009057Homeodomain-like
CDDcd001673.56E-91661No hitNo description
Gene3DG3DSA:1.10.10.601.8E-66588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTSE EDEILAKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SAQEENTIVK LHASLGNRSA PLYYT*
Functional Description ? help Back to Top
Source Description
UniProtFlavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00668SELEXTransfer from GRMZM2G016020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang06g16250.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0934636e-94BT093463.1 Soybean clone JCVI-FLGm-17G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017413931.18e-57PREDICTED: transcription factor MYB12-like
SwissprotQ9FJ077e-49MY111_ARATH; Transcription factor MYB111
TrEMBLA0A0L9TWH02e-55A0A0L9TWH0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SSH32e-55A0A0S3SSH3_PHAAN; Uncharacterized protein
STRINGXP_008350120.11e-54(Malus domestica)
STRINGGLYMA02G01740.12e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.13e-51myb domain protein 111
Publications ? help Back to Top
  1. Pandey A,Misra P,Bhambhani S,Bhatia C,Trivedi PK
    Expression of Arabidopsis MYB transcription factor, AtMYB111, in tobacco requires light to modulate flavonol content.
    Sci Rep, 2014. 4: p. 5018
    [PMID:24846090]
  2. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  3. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  4. Zhou Z,Schenke D,Miao Y,Cai D
    Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings.
    Plant Cell Environ., 2017. 40(3): p. 453-458
    [PMID:28032363]
  5. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  6. Duan S, et al.
    Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana.
    Plant Sci., 2018. 268: p. 47-53
    [PMID:29362083]