PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna

Family

MYB

Protein Properties

Length: 243aa MW: 27771.9 Da PI: 4.5115

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Vang06g06000.1	genome	SNU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	32.8	1.6e-10	15	44	1	30
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 rg+W++eEd++l+++v+++G g W I+r+ Vang06g06000.1 15 RGPWSAEEDQILINYVHLHGEGKWGQISRR 44 89*************************996 PP
2	Myb_DNA-binding	51.3	2.6e-16	49	94	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++ +lG++ W++Ia +++ gRt++++k++w++yl Vang06g06000.1 49 RGNISSDEEDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTYL 94 78999***************.*****.***********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-10	10	44	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.35E-20	14	90	IPR009057	Homeodomain-like
SMART	SM00717	3.1	14	46	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-8	15	44	IPR001005	SANT/Myb domain
CDD	cd00167	1.98E-11	17	94	No hit	No description
PROSITE profile	PS51294	24.347	44	98	IPR017930	Myb domain
SMART	SM00717	1.7E-15	48	96	IPR001005	SANT/Myb domain
Pfam	PF00249	8.1E-15	49	94	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-21	50	95	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 243 aa Download sequence Send to blast
MKRKGAYENQ EAVNRGPWSA EEDQILINYV HLHGEGKWGQ ISRRTDIKRG NISSDEEDLI 60 IRLHSLLGNR WSLIAGRLPG RTDNEIKNYW NTYLRKKVEE KHNDNNNNIP VELRMESSNA 120 FGIAIDPAKS SEAVMCTEVM MATEAVNDSV NTKNLMSTNY IENPFASVPA DHPEGLGKQF 180 DLSELLMPQE GCDFNGYACV EIPPHFGEHS CRVNDAMCET WYDDWKNEDY FPLDYDMDFP 240 LF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	5e-18	13	98	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269\|PubMed:15361138}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Vang06g06000.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015041	0.0	AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014513204.1	1e-172	transcription factor MYB23
Swissprot	Q9FJA2	3e-35	TT2_ARATH; Transcription factor TT2
TrEMBL	A0A0L9TZ59	0.0	A0A0L9TZ59_PHAAN; Uncharacterized protein
STRING	XP_007143770.1	1e-122	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF15511	5	12

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G35550.1	1e-37	MYB family protein

Publications ? help Back to Top
Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Liu C,Jun JH,Dixon RA MYB5 and MYB14 Play Pivotal Roles in Seed Coat Polymer Biosynthesis in Medicago truncatula. Plant Physiol., 2014. 165(4): p. 1424-1439 [PMID:24948832] Zhu Z, et al. Characterization of the cis elements in the proximal promoter regions of the anthocyanin pathway genes reveals a common regulatory logic that governs pathway regulation. J. Exp. Bot., 2015. 66(13): p. 3775-89 [PMID:25911741] Liu Y,Shi Z,Maximova SN,Payne MJ,Guiltinan MJ Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao. BMC Plant Biol., 2015. 15: p. 160 [PMID:26109181] Yang K, et al. Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li Y, et al. Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis. Sci Rep, 2016. 6: p. 30514 [PMID:27465838] Li C,Zhang B,Chen B,Ji L,Yu H Site-specific phosphorylation of TRANSPARENT TESTA GLABRA1 mediates carbon partitioning in Arabidopsis seeds. Nat Commun, 2018. 9(1): p. 571 [PMID:29422671]