![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang05g04250.1 | ||||||||
Common Name | LR48_Vigan04g236500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 202aa MW: 22356.3 Da PI: 10.1782 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46 | 1.2e-14 | 96 | 140 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++ ++ + ++lG+g+W+ I++ + k+Rt+ q+ s+ qky Vang05g04250.1 96 AWTEEEHKVFLLGLQKLGKGNWRGISKSFVKTRTPVQVASHAQKY 140 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50158 | 8.763 | 5 | 22 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 17.207 | 89 | 145 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.3E-17 | 91 | 145 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.5E-17 | 92 | 144 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.0E-9 | 93 | 143 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-11 | 93 | 139 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.7E-12 | 96 | 140 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.18E-10 | 96 | 141 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MGIARKCSYC GKLGHNSRTC KSPLGHGDLK LFGVQLDISS SSSSTISFSS PSYSALTNHF 60 FSSSPSFRDE NQNSDAFLLT ANTLLSRIQD TKKGVAWTEE EHKVFLLGLQ KLGKGNWRGI 120 SKSFVKTRTP VQVASHAQKY FLRQSHNTFH KTKHSRTLFH VPSSSTSTSS SSNCTAQMPH 180 PDLELKLATP MPLELYQMHE F* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang05g04250.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 0.0 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017421480.1 | 1e-148 | PREDICTED: transcription factor MYB1R1-like | ||||
Swissprot | Q7XC57 | 5e-36 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A0L9UHY1 | 1e-146 | A0A0L9UHY1_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3RBN6 | 1e-146 | A0A0S3RBN6_PHAAN; Uncharacterized protein | ||||
STRING | XP_007136823.1 | 2e-86 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15142 | 10 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56840.1 | 3e-37 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|