PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang05g01610.1 | ||||||||
Common Name | LR48_Vigan09g019100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 221aa MW: 24384.9 Da PI: 8.2505 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.8 | 5e-18 | 28 | 73 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd +l +v ++G+++W++I+r++ gR++k+c++rw + Vang05g01610.1 28 KGPWSAEEDRILTSLVDRYGPRNWSLISRYIK-GRSGKSCRLRWCNQ 73 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 59.4 | 7.9e-19 | 82 | 124 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++++Ede ++ a++q+G++ W+tIar ++ gRt++ +k++w++ Vang05g01610.1 82 PFSPQEDETIIAAHAQYGNR-WATIARLLP-GRTDNAVKNHWNST 124 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.59 | 23 | 78 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.73E-31 | 25 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-15 | 27 | 76 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-17 | 28 | 73 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.5E-25 | 29 | 81 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.48E-14 | 30 | 72 | No hit | No description |
SMART | SM00717 | 3.8E-16 | 79 | 127 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 22.112 | 79 | 129 | IPR017930 | Myb domain |
CDD | cd00167 | 3.58E-13 | 82 | 125 | No hit | No description |
Pfam | PF00249 | 1.6E-15 | 82 | 124 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.9E-24 | 82 | 128 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MEAINRTSST ASSSSDSSSS DSNPHRIKGP WSAEEDRILT SLVDRYGPRN WSLISRYIKG 60 RSGKSCRLRW CNQLSPTVQH RPFSPQEDET IIAAHAQYGN RWATIARLLP GRTDNAVKNH 120 WNSTLKRRAK AFLDINVNNA NNEAATSSAP PRSFDDDPLT ALTLAPPGLS SAAVAEDTVL 180 DHRVSPESAP AGFWDMMRDV IAREVKEYVS SNFSDNSNFH * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 5e-42 | 23 | 129 | 53 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 5e-42 | 23 | 129 | 53 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang05g01610.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 0.0 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017435553.1 | 1e-161 | PREDICTED: transcriptional activator Myb-like | ||||
Swissprot | Q9SN12 | 5e-57 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A0L9V9H5 | 1e-160 | A0A0L9V9H5_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3RBA8 | 1e-160 | A0A0S3RBA8_PHAAN; Uncharacterized protein | ||||
STRING | XP_007136655.1 | 1e-126 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5074 | 32 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 2e-58 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|