PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang04g14840.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 95aa MW: 10279.1 Da PI: 10.5746 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 137.5 | 3e-43 | 30 | 94 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + +GlnPGlivllvvgglll+flvgn++ly+yaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe Vang04g14840.1 30 ASNQGLNPGLIVLLVVGGLLLTFLVGNFVLYTYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE 94 5569************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 3.1E-40 | 31 | 94 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MSAKHEFSAS AMADDFEFAD KVPPSFDRVA SNQGLNPGLI VLLVVGGLLL TFLVGNFVLY 60 TYAQKTLPPR KKKPVSKKKM KKERLKQGVS APGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang04g14840.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015037 | 1e-107 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014495220.1 | 7e-54 | DNA-binding protein S1FA | ||||
Refseq | XP_017416263.1 | 7e-54 | PREDICTED: DNA-binding protein S1FA-like | ||||
Swissprot | Q7XLX6 | 4e-15 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A0L9U910 | 2e-52 | A0A0L9U910_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3RYM8 | 2e-52 | A0A0S3RYM8_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A1S3TN66 | 2e-52 | A0A1S3TN66_VIGRR; DNA-binding protein S1FA | ||||
STRING | XP_007162731.1 | 6e-28 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5409 | 33 | 55 |
Publications ? help Back to Top | |||
---|---|---|---|
|