![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang04g05880.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 130aa MW: 14311.1 Da PI: 10.0962 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 116.4 | 1.2e-36 | 14 | 68 | 6 | 60 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +cprC s+ntkfCyynnys +qPryfCk+CrryWtkGG+lrnvP+Ggg+rk+++ Vang04g05880.1 14 PNCPRCGSSNTKFCYYNNYSSTQPRYFCKGCRRYWTKGGSLRNVPIGGGCRKSRR 68 58**************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 8.0E-25 | 10 | 68 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.192 | 14 | 68 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.5E-31 | 14 | 68 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 16 | 52 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MERGWKANSV EISPNCPRCG SSNTKFCYYN NYSSTQPRYF CKGCRRYWTK GGSLRNVPIG 60 GGCRKSRRGK YNKALRQAHG PVGHSDDLRP SSSVVSDGPN IDLAQVYASF LNVKPDQDET 120 STGSPKLKL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang04g05880.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015037 | 0.0 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017416764.1 | 2e-83 | PREDICTED: dof zinc finger protein DOF3.5 | ||||
Swissprot | Q9SVC5 | 4e-42 | DOF35_ARATH; Dof zinc finger protein DOF3.5 | ||||
TrEMBL | A0A0L9U9D0 | 5e-82 | A0A0L9U9D0_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3RZC2 | 5e-82 | A0A0S3RZC2_PHAAN; Uncharacterized protein | ||||
STRING | XP_007162976.1 | 2e-74 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1817 | 33 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G52440.1 | 2e-44 | Dof family protein |