![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0394s00050.1 | ||||||||
Common Name | LR48_Vigan10g230400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 219aa MW: 24200.3 Da PI: 6.0019 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.6 | 6.6e-09 | 5 | 33 | 20 | 48 |
TTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 20 GggtWktIartmgkgRtlkqcksrwqkyl 48 G g+W+ Iar g+ R++k+c++rw +yl Vang0394s00050.1 5 GQGCWSDIARNAGLQRCGKSCRLRWINYL 33 7789***********************97 PP | |||||||
2 | Myb_DNA-binding | 53.8 | 4.5e-17 | 39 | 83 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++ Vang0394s00050.1 39 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNST 83 89********************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.458 | 1 | 33 | IPR017930 | Myb domain |
SMART | SM00717 | 80 | 2 | 35 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-15 | 4 | 40 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.6E-7 | 5 | 33 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.78E-5 | 5 | 33 | No hit | No description |
SuperFamily | SSF46689 | 2.26E-21 | 19 | 92 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.346 | 34 | 88 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-16 | 38 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.3E-16 | 39 | 83 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.54E-13 | 41 | 84 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.1E-27 | 41 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MITKGQGCWS DIARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSLLGNR 60 WSQIAARLPG RTDNEIKNFW NSTLKKRLKM SSSNINNTSS PNNSDSSDPR DVMGGIMPMN 120 DQHDLMTMCM DSSSSTSSSS MQSMQANMAL TDQFDPFPLL SNRYDMTTGA AGFLDNMAAC 180 LNQVGMVDHD DGVVHGGYGA LEPNKMGLES DFSLPPLES |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-22 | 5 | 88 | 26 | 108 | B-MYB |
1h8a_C | 2e-22 | 5 | 88 | 46 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 83 | 89 | LKKRLKM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0394s00050.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 0.0 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017439288.1 | 1e-162 | PREDICTED: transcription factor MYB3-like | ||||
Swissprot | Q9C6U1 | 2e-55 | MYB83_ARATH; Transcription factor MYB83 | ||||
TrEMBL | A0A0L9VND5 | 1e-161 | A0A0L9VND5_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3T882 | 1e-161 | A0A0S3T882_PHAAN; Uncharacterized protein | ||||
STRING | XP_007151435.1 | 1e-123 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF774 | 34 | 128 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12870.1 | 9e-48 | myb domain protein 46 |
Publications ? help Back to Top | |||
---|---|---|---|
|