PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0196s00170.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 181aa MW: 20434.1 Da PI: 10.6239 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 93.3 | 2.9e-29 | 29 | 85 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+ +q a le+++kl +k+rkpylheSRh hAl+R+RgsgGrF Vang0196s00170.1 29 EEPIFVNAKQYHAILRGKQYWATLESQNKL-IKERKPYLHESRHLHALKRARGSGGRF 85 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 9.0E-33 | 27 | 88 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 33.756 | 28 | 88 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.3E-23 | 30 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.1E-19 | 31 | 53 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.1E-19 | 62 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MLSKYGQIHP AQLIGMPTAR IPLPLNLSEE PIFVNAKQYH AILRGKQYWA TLESQNKLIK 60 ERKPYLHESR HLHALKRARG SGGRFLNTKK HEESKPTSQN HDIDVSRCTH LNLRGNMSES 120 KARQLNYRDG ASTTTCSDIS SASNSSDLFQ QHQSDIRLCA SSNIGHSSRK SKRKKDLNFI 180 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-20 | 29 | 100 | 2 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 168 | 175 | RKSKRKKD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0196s00170.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 0.0 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017417946.1 | 1e-107 | PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1 | ||||
Swissprot | Q93ZH2 | 1e-40 | NFYA3_ARATH; Nuclear transcription factor Y subunit A-3 | ||||
Swissprot | Q9LNP6 | 1e-40 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | A0A0L9VJY4 | 1e-117 | A0A0L9VJY4_PHAAN; Uncharacterized protein | ||||
TrEMBL | A0A0S3TA38 | 1e-119 | A0A0S3TA38_PHAAN; Uncharacterized protein | ||||
STRING | XP_007135485.1 | 7e-76 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10120 | 25 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72830.1 | 1e-37 | nuclear factor Y, subunit A3 |
Publications ? help Back to Top | |||
---|---|---|---|
|