 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Vang0114s00450.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
Family |
Trihelix |
Protein Properties |
Length: 73aa MW: 8649.08 Da PI: 10.7531 |
Description |
Trihelix family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Vang0114s00450.1 | genome | SNU | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | trihelix | 54.4 | 3.4e-17 | 1 | 49 | 38 | 87 |
trihelix 38 mrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
mr+ g++r+ k+Ckekw+n+nk++kk+ke++k+r ++s+ cpyf+ql+a
Vang0114s00450.1 1 MRKLGYNRNTKRCKEKWDNINKYFKKVKESNKRR-LKDSKMCPYFNQLDA 49
8999****************************98.67788********85 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AP015043 | 1e-119 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. |