|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Vang0041ss00850.9 |
Common Name | LR48_Vigan04g176800 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
Family |
NAC |
Protein Properties |
Length: 35aa MW: 3934.6 Da PI: 5.5649 |
Description |
NAC family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Vang0041ss00850.9 | genome | SNU | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 26.1 | 2.4e-08 | 2 | 32 | 17 | 48 |
NAM 17 eyLkkkvegkkleleevikevdiykvePwdLp 48
+yL++k++++++ + +i+e+d+yk++PwdLp
Vang0041ss00850.9 2 HYLCRKCASQPIAV-PIIAEIDLYKYDPWDLP 32
8***********99.88**************9 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0009611 | Biological Process | response to wounding |
GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway |
GO:0005634 | Cellular Component | nucleus |
GO:0003677 | Molecular Function | DNA binding |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AP015035 | 2e-51 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Publications
? help Back to Top |
- Florentin A,Damri M,Grafi G
Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] - Jensen MK, et al.
ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] - Wang YX
Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] - Yang X, et al.
Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] - Du Q,Wang H
The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] - Yang K, et al.
Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8 [PMID:26460024] - Takasaki H, et al.
SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] - Liu Y,Sun J,Wu Y
Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] - Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] - Zhao J,Missihoun TD,Bartels D
The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]
|