PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7DS_7B303CBAF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 54aa MW: 6471.37 Da PI: 11.4274 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 54.3 | 2.6e-17 | 1 | 35 | 43 | 77 |
CG-1 43 nrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77 nr++ r+frkDGy w++kkdg+tv E+he+LK + Traes_7DS_7B303CBAF.1 1 NRRVNRFFRKDGYAWRRKKDGRTVGEAHERLKSCQ 35 89******************************655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03859 | 8.0E-12 | 1 | 38 | IPR005559 | CG-1 DNA-binding domain |
PROSITE profile | PS51437 | 24.385 | 1 | 54 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 54 aa Download sequence Send to blast |
NRRVNRFFRK DGYAWRRKKD GRTVGEAHER LKSCQQERVP PVRTSRTGCA CPFY |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024311654.1 | 6e-16 | calmodulin-binding transcription activator 4 isoform X4 | ||||
STRING | Traes_2AS_AE392E835.1 | 5e-33 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G67310.1 | 2e-13 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains |
Publications ? help Back to Top | |||
---|---|---|---|
|