PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_15FC3C682.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family M-type_MADS
Protein Properties Length: 78aa    MW: 8389.74 Da    PI: 11.1789
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_15FC3C682.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.45.2e-201057249
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                           r+e k  rqvtfskR+ g+ KKA EL vLC a  a+++fs+ gk + +
  Traes_7DL_15FC3C682.1 10 RVEKKESRQVTFSKRKSGLWKKAAELAVLCRASLAIVVFSEAGKAFAF 57
                           78999**************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.151161IPR002100Transcription factor, MADS-box
SMARTSM004326.1E-24160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-23268IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-19323IPR002100Transcription factor, MADS-box
PfamPF003194.7E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
KGRQRRENRR VEKKESRQVT FSKRKSGLWK KAAELAVLCR ASLAIVVFSE AGKAFAFGSP  60
STDAVLGCAD ALAPVPAA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020191502.11e-47agamous-like MADS-box protein AGL61
SwissprotO647034e-18AGL29_ARATH; Agamous-like MADS-box protein AGL29
SwissprotQ9FKK21e-17AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A3B6SIN51e-46A0A3B6SIN5_WHEAT; Uncharacterized protein
STRINGTraes_7DL_15FC3C682.13e-48(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-20AGAMOUS-like 29
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  3. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  4. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  5. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  6. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]