![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BL_FB5FAC1E8.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 156aa MW: 17689.9 Da PI: 10.4898 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 169.9 | 8.3e-53 | 22 | 149 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 l+pGfrFhPtdeelv++yLk+kv g++l++ ++i+evd+ykvePwdLp+ ++++++++wyfFs+ d+k+a+ r+nrat+ gyWk+t Traes_7BL_FB5FAC1E8.2 22 LAPGFRFHPTDEELVSYYLKRKVLGRPLKV-DAIAEVDLYKVEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRATAGGYWKTT 108 579***************************.99***************4357888999****************************** PP NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 gkd+ev + + ++vg+kktLvf+ grapkge+t+Wvmhe rl Traes_7BL_FB5FAC1E8.2 109 GKDREVRH-GARVVGMKKTLVFHAGRAPKGERTNWVMHEDRL 149 ********.999**************************9765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.4E-56 | 19 | 153 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.247 | 22 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.3E-28 | 24 | 146 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MTHPSSSSSS APAAAPDDPT SLAPGFRFHP TDEELVSYYL KRKVLGRPLK VDAIAEVDLY 60 KVEPWDLPAR SRLRSRDSQW YFFSRLDRKH ANRARTNRAT AGGYWKTTGK DREVRHGARV 120 VGMKKTLVFH AGRAPKGERT NWVMHEDRLE GDGLVD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-47 | 21 | 149 | 14 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM027574 | 0.0 | HM027574.2 Triticum aestivum NAC transcription factor NTL5 (NTL5) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020181541.1 | 1e-104 | NAC domain-containing protein 78-like | ||||
Swissprot | Q84K00 | 1e-68 | NAC78_ARATH; NAC domain-containing protein 78 | ||||
TrEMBL | A0A446YGY0 | 1e-104 | A0A446YGY0_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446YH13 | 1e-104 | A0A446YH13_TRITD; Uncharacterized protein | ||||
STRING | Traes_7BL_FB5FAC1E8.2 | 1e-111 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7107 | 36 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04410.1 | 1e-62 | NAC domain containing protein 2 |