PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BL_46B9DD8C8.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 96aa MW: 11291.2 Da PI: 10.7622 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 103.5 | 2.7e-32 | 1 | 72 | 56 | 128 |
NAM 56 kewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 kewyf+s rd+kyatg+r+nrat+sgyWkatgkd+++ + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r Traes_7BL_46B9DD8C8.1 1 KEWYFYSLRDRKYATGQRTNRATESGYWKATGKDRAISR-KGLLVGMRKTLVFYEGRAPKGKKTEWVMHEFRK 72 59***********************************99.999****************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 33.442 | 1 | 96 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 5.49E-33 | 1 | 77 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-14 | 3 | 71 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
KEWYFYSLRD RKYATGQRTN RATESGYWKA TGKDRAISRK GLLVGMRKTL VFYEGRAPKG 60 KKTEWVMHEF RKEGQGDLMK LPLKVSIIII IHVEQI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-28 | 1 | 71 | 71 | 141 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-28 | 1 | 71 | 71 | 141 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-28 | 1 | 71 | 71 | 141 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-28 | 1 | 71 | 71 | 141 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
3swm_B | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
3swm_C | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
3swm_D | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
3swp_A | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
3swp_B | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
3swp_C | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
3swp_D | 2e-28 | 1 | 71 | 74 | 144 | NAC domain-containing protein 19 |
4dul_A | 2e-28 | 1 | 71 | 71 | 141 | NAC domain-containing protein 19 |
4dul_B | 2e-28 | 1 | 71 | 71 | 141 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM027572 | 1e-137 | HM027572.1 Triticum aestivum NAC transcription factor 7 (NAC7) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188633.1 | 1e-56 | NAC domain-containing protein 21/22-like | ||||
Swissprot | Q84TE6 | 2e-41 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A453SXG3 | 2e-63 | A0A453SXG3_AEGTS; Uncharacterized protein | ||||
STRING | Traes_7BL_46B9DD8C8.1 | 8e-65 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1012 | 37 | 138 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56010.2 | 5e-43 | NAC domain containing protein 1 |