PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AS_EFE436F1D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family M-type_MADS
Protein Properties Length: 71aa    MW: 7971.42 Da    PI: 11.4768
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AS_EFE436F1D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.51.3e-261059251
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           rien s rq tfskR  g+lKKA EL +LCd++v+vi+fsstg+lyey+s
  Traes_7AS_EFE436F1D.1 10 RIENMSSRQATFSKRCRGLLKKARELAILCDVQVSVIVFSSTGRLYEYAS 59
                           8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.5E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.861161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-26261IPR002100Transcription factor, MADS-box
CDDcd002658.60E-33260No hitNo description
PRINTSPR004049.6E-26323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 71 aa     Download sequence    Send to blast
MGRGKIVIRR IENMSSRQAT FSKRCRGLLK KARELAILCD VQVSVIVFSS TGRLYEYASP  60
IAATTMGHLQ R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-17159159MEF2C
5f28_B2e-17159159MEF2C
5f28_C2e-17159159MEF2C
5f28_D2e-17159159MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020153465.16e-33MADS-box transcription factor ANR1-like
SwissprotQ9SI384e-26ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLA0A3B6TJM86e-31A0A3B6TJM8_WHEAT; Uncharacterized protein
STRINGTraes_7AS_EFE436F1D.15e-45(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.12e-28AGAMOUS-like 44
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Yan Y,Wang H,Hamera S,Chen X,Fang R
    miR444a has multiple functions in the rice nitrate-signaling pathway.
    Plant J., 2014. 78(1): p. 44-55
    [PMID:24460537]
  4. Lei L, et al.
    Nitrogen use efficiency is regulated by interacting proteins relevant to development in wheat.
    Plant Biotechnol. J., 2018. 16(6): p. 1214-1226
    [PMID:29193541]
  5. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]