PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_6BS_993CBD840.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 78aa MW: 9209.47 Da PI: 10.9499

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_6BS_993CBD840.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	49	1.3e-15	2	63	1	62
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke kr +r+ +NR++A+ R+RKka++ Le kvk Le++N++L ++ ++l++e + l++ Traes_6BS_993CBD840.1 2 DKEHKRLKRLLRNRVSAQQARERKKAYLGDLEVKVKDLEKKNSELEERHSTLQNENQMLRQI 63 6899*****************************************************99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.2E-14	2	66	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.0E-14	3	64	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	12.036	4	67	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.8E-17	6	66	No hit	No description
SuperFamily	SSF57959	2.0E-14	6	64	No hit	No description
CDD	cd14704	4.10E-12	7	58	No hit	No description
PROSITE pattern	PS00036	0	9	24	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
ADKEHKRLKR LLRNRVSAQQ ARERKKAYLG DLEVKVKDLE KKNSELEERH STLQNENQML 60 RQILKNTTVS RRGPSEGQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	1e-14	27	66	3	42	Transcription factor HY5
2oqq_B	1e-14	27	66	3	42	Transcription factor HY5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK365526	1e-128	AK365526.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034M24.
GenBank	AK375815	1e-128	AK375815.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3106C21.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003571497.1	7e-49	transcription factor HY5
Swissprot	Q9SM50	3e-33	HY5_SOLLC; Transcription factor HY5
TrEMBL	I1HYI4	2e-47	I1HYI4_BRADI; Uncharacterized protein
STRING	BRADI3G07540.1	3e-48	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1408	38	111

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	6e-35	bZIP family protein

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]