PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MIKC_MADS

Protein Properties

Length: 203aa MW: 22762.7 Da PI: 6.0283

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_6BS_8F1EC63B9.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	33.5	5.3e-11	1	23	21	43
HHHHHHHHHHHT-EEEEEEE-TT CS SRF-TF 21 lKKAeELSvLCdaevaviifsst 43 +KKA EL vLCda+vavi++ss+ Traes_6BS_8F1EC63B9.1 1 MKKARELAVLCDAQVAVIVLSSS 23 8********************86 PP
2	K-box	84.5	2.2e-28	44	141	1	98
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 yq+++g+sl+++++e++q+ l++Lk+ ++nL++e+R+++GedL+ L+++eL+ Leq++ +l+ +R++K++++++q+e+ +kk k + Traes_6BS_8F1EC63B9.1 44 YQQATGTSLWTEQYENMQRTLSQLKDINRNLRTEIRQRMGEDLDALEFQELRGLEQNVGAALEVVRQRKYHVITRQTETYKKKVKHSE 131 89999********************************************************************************* PP K-box 89 eenkaLrkkl 98 e k+L+++l Traes_6BS_8F1EC63B9.1 132 EVYKKLKQEL 141 *****987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	11.479	1	33	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.8E-8	1	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.14E-14	1	68	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.6E-20	55	141	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.795	57	147	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 203 aa Download sequence Send to blast
MKKARELAVL CDAQVAVIVL SSSASYCSSS SDATCSIKGV FDRYQQATGT SLWTEQYENM 60 QRTLSQLKDI NRNLRTEIRQ RMGEDLDALE FQELRGLEQN VGAALEVVRQ RKYHVITRQT 120 ETYKKKVKHS EEVYKKLKQE LSMREDPAFG FMDNPVMGGW DGVAAVEMGG DGSEADMYAF 180 HAVSSQLDLH GMAYGSSHCP LFG

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269\|PubMed:12506001, ECO:0000269\|PubMed:12905025, ECO:0000269\|PubMed:14558657}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM502879	1e-177	AM502879.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM13 (WM13 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020148658.1	1e-127	MADS-box transcription factor 16-like
Swissprot	Q944S9	1e-89	MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBL	A0A3B6PJ07	1e-138	A0A3B6PJ07_WHEAT; Uncharacterized protein
STRING	Traes_6BS_8F1EC63B9.1	1e-152	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5728	35	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	6e-38	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Chen ZX, et al. Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice. Planta, 2006. 223(5): p. 882-90 [PMID:16254725] Zhang Q, et al. Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull. J Genet Genomics, 2007. 34(6): p. 519-26 [PMID:17601611] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Xiao H, et al. STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice. Plant J., 2009. 59(5): p. 789-801 [PMID:19453444] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Ohmori S,Tabuchi H,Yatou O,Yoshida H Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation. Breed. Sci., 2012. 62(2): p. 124-32 [PMID:23136523] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Lombardo F, et al. The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]