 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Traes_6BL_2F2381640.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
| Family |
MYB_related |
| Protein Properties |
Length: 105aa MW: 12160.5 Da PI: 10.1527 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Traes_6BL_2F2381640.1 | genome | IWGSC | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 56.9 | 4.9e-18 | 49 | 93 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
r +WT+eE++++++a +++G W++I +++g ++t+ q++s+ qk+
Traes_6BL_2F2381640.1 49 REKWTEEEHKRFLEALQLHGRA-WRRIQEHIG-TKTAVQIRSHAQKF 93
789*****************88.*********.************98 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0007623 | Biological Process | circadian rhythm |
| GO:0009734 | Biological Process | auxin-activated signaling pathway |
| GO:0010600 | Biological Process | regulation of auxin biosynthetic process |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | JF951941 | 1e-176 | JF951941.1 Triticum aestivum clone TaMYB58 MYB-related protein mRNA, complete cds. |
| Publications
? help Back to Top |
- Zhang L,Zhao G,Jia J,Liu X,Kong X
Molecular characterization of 60 isolated wheat MYB genes and analysis of their expression during abiotic stress.
J. Exp. Bot., 2012. 63(1): p. 203-14
[PMID:21934119] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Xu G, et al.
REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis.
Photosyn. Res., 2015. 126(2-3): p. 331-40
[PMID:25910753] - Jiang Z,Xu G,Jing Y,Tang W,Lin R
Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
Nat Commun, 2016. 7: p. 12377
[PMID:27506149]
|
