PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 93aa MW: 10828.6 Da PI: 9.7176

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5DS_866BAC69D.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.1	1.8e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +iifs++gklye+s+ Traes_5DS_866BAC69D.1 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIIFSTKGKLYEFST 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.941	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.9E-40	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.67E-35	2	85	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.15E-40	2	76	No hit	No description
PRINTS	PR00404	2.9E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.1E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.9E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIIFST KGKLYEFSTE 60 SCMDKILERY ERYSYAEKVL VSSESEIQRT YCL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	5e-23	1	74	1	73	MEF2 CHIMERA
6byy_B	5e-23	1	74	1	73	MEF2 CHIMERA
6byy_C	5e-23	1	74	1	73	MEF2 CHIMERA
6byy_D	5e-23	1	74	1	73	MEF2 CHIMERA
6bz1_A	5e-23	1	74	1	73	MEF2 CHIMERA
6bz1_B	5e-23	1	74	1	73	MEF2 CHIMERA
6bz1_C	5e-23	1	74	1	73	MEF2 CHIMERA
6bz1_D	5e-23	1	74	1	73	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|Ref.9}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM502869	1e-146	AM502869.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM6 (WM6 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020198021.1	4e-58	MADS-box transcription factor 14-like
Swissprot	Q10CQ1	8e-54	MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBL	A0A120MFJ5	2e-57	A0A120MFJ5_TRITI; VRN-A1
TrEMBL	A0A346QRN0	2e-57	A0A346QRN0_9POAL; VRN-A1
TrEMBL	A0A346QRN1	2e-57	A0A346QRN1_TRITD; VRN-A1
TrEMBL	B6D8M3	2e-57	B6D8M3_TRIMO; MADS-box transcriptional factor VRN1
TrEMBL	H9XFT0	2e-57	H9XFT0_WHEAT; VRN-A1
TrEMBL	Q5ETV1	2e-57	Q5ETV1_WHEAT; MIKC-type MADS-box transcription factor WM6
TrEMBL	Q5ETV2	2e-57	Q5ETV2_WHEAT; VRN-A1
TrEMBL	Q5ETV3	2e-57	Q5ETV3_TRITU; VRN-A1
TrEMBL	Q84KI0	2e-57	Q84KI0_TRIMO; MADS box transcription factor AP1
STRING	Traes_5DS_866BAC69D.1	7e-61	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	1e-50	MIKC_MADS family protein

Publications ? help Back to Top
Jia H, et al. Characterization and transcriptional profiles of two rice MADS-box genes. Plant Sci., 2000. 155(2): p. 115-122 [PMID:10814814] Jang S,An K,Lee S,An G Characterization of tobacco MADS-box genes involved in floral initiation. Plant Cell Physiol., 2002. 43(2): p. 230-8 [PMID:11867703] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465] Li D, et al. Functional characterization of rice OsDof12. Planta, 2009. 229(6): p. 1159-69 [PMID:19198875] Tanaka N, et al. The COP1 ortholog PPS regulates the juvenile-adult and vegetative-reproductive phase changes in rice. Plant Cell, 2011. 23(6): p. 2143-54 [PMID:21705640] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Su L,Shan JX,Gao JP,Lin HX OsHAL3, a Blue Light-Responsive Protein, Interacts with the Floral Regulator Hd1 to Activate Flowering in Rice. Mol Plant, 2016. 9(2): p. 233-244 [PMID:26537047] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]