 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Traes_5DS_3EBE121C7.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
Family |
M-type_MADS |
Protein Properties |
Length: 108aa MW: 12156 Da PI: 10.6051 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Traes_5DS_3EBE121C7.1 | genome | IWGSC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 85.6 | 2.8e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
+ri+n +nrqvtfskRr g++KKA EL +LCda+ a+i+fsstg+ly+++s
Traes_5DS_3EBE121C7.1 9 ERIDNATNRQVTFSKRRGGLMKKARELAILCDADLALIVFSSTGRLYDFAS 59
69***********************************************86 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AM502902 | 1e-133 | AM502902.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM31B (WM31B gene). |
Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Brenchley R, et al.
Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] - Puig J, et al.
Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] - Yu C, et al.
The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876]
|