PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Function |

Regulation |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

Traes_5DL_9F8A19A00.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

ZF-HD

Protein Properties

Length: 93aa MW: 10231.4 Da PI: 7.6631

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5DL_9F8A19A00.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	91.8	6e-29	18	76	1	60
ZF-HD_dimer 1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +++vrY eC++NhAas+Gg+avDGC+Ef+++ geegt alkC+ACgCHR+FH r +++e Traes_5DL_9F8A19A00.1 18 CCGVRYGECRRNHAASTGGYAVDGCREFIAE-GEEGTFGALKCSACGCHRSFHHRVQVYE 76 5789************************8.999******************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	5.0E-26	1	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	8.3E-28	21	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	8.2E-22	22	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.413	23	72	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MKRLVVLRRC EPIVRFSCCG VRYGECRRNH AASTGGYAVD GCREFIAEGE EGTFGALKCS 60 ACGCHRSFHH RVQVYEVAWD CESDTSSSSS SSS

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK375715	1e-126	AK375715.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3102E24.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020146636.1	7e-62	mini zinc finger protein 3-like
Swissprot	Q6ER22	4e-34	MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBL	A0A446T433	2e-60	A0A446T433_TRITD; Uncharacterized protein
TrEMBL	A0A453KXK4	2e-60	A0A453KXK4_AEGTS; Uncharacterized protein
TrEMBL	W5FWN3	2e-60	W5FWN3_WHEAT; Uncharacterized protein
STRING	MLOC_45078.4	2e-61	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-26	mini zinc finger 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]