PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Function |

Regulation |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

Traes_5DL_1F0881CE1.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

ZF-HD

Protein Properties

Length: 94aa MW: 9841.97 Da PI: 7.3403

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5DL_1F0881CE1.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	94	1.2e-29	28	81	3	58
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 v+YkeC++NhAa +Gg+avDGC+Efm+s + a+al CaACgCHR+FH+reve Traes_5DL_1F0881CE1.1 28 VVHYKECQRNHAAGIGGYAVDGCREFMASAP--AGAEALLCAACGCHRSFHKREVE 81 689***********************944..459***************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-11	27	92	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	1.8E-26	29	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.3E-23	30	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.151	31	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MGPQQDRSAS KALANGTAVA PERKDGKVVH YKECQRNHAA GIGGYAVDGC REFMASAPAG 60 AEALLCAACG CHRSFHKREV EAVDCDCSSD TSGR

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK360421	1e-153	AK360421.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1117M15.
GenBank	AK361357	1e-153	AK361357.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138M11.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020160851.1	1e-63	mini zinc finger protein 1-like
Swissprot	B8BIU8	2e-32	MIF1_ORYSI; Mini zinc finger protein 1
Swissprot	Q2RB28	2e-32	MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBL	A0A446U3C7	3e-62	A0A446U3C7_TRITD; Uncharacterized protein
TrEMBL	A0A453KBU4	3e-62	A0A453KBU4_AEGTS; Uncharacterized protein
TrEMBL	F2D959	3e-62	F2D959_HORVV; Predicted protein
TrEMBL	W5FC48	3e-62	W5FC48_WHEAT; Uncharacterized protein
STRING	Traes_5BL_6054E8EC9.1	5e-63	(Triticum aestivum)
STRING	Traes_5DL_1F0881CE1.1	5e-63	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-17	mini zinc finger 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]