PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5BL_F80E01D65.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 124aa MW: 13452.3 Da PI: 10.1165 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 72.9 | 6e-23 | 30 | 88 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+++++e++ ++e+iswse+g+sfvv+++ e+a+++Lp +Fkh nf+SFvRQLn+Y Traes_5BL_F80E01D65.1 30 FLTKTHQMVEERGTDEVISWSEHGRSFVVWKPVELARDLLPLHFKHCNFSSFVRQLNTY 88 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.2E-25 | 25 | 89 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 5.7E-23 | 26 | 105 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 2.58E-21 | 26 | 91 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.1E-12 | 30 | 53 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.5E-19 | 30 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.1E-12 | 68 | 80 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.1E-12 | 81 | 93 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MAGAAAQQQQ KGGGGGGGVV RVGGGGPAPF LTKTHQMVEE RGTDEVISWS EHGRSFVVWK 60 PVELARDLLP LHFKHCNFSS FVRQLNTYVR IPPSSKHTLS LQYSTSAFAK LITPVCTTDQ 120 RLTT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1hks_A | 4e-15 | 23 | 88 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
1hkt_A | 4e-15 | 23 | 88 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF208549 | 1e-141 | KF208549.1 Triticum aestivum heat shock factor B1b (HsfB1b) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020177659.1 | 3e-43 | heat stress transcription factor B-1-like | ||||
Swissprot | Q67TP9 | 1e-34 | HSFB1_ORYSJ; Heat stress transcription factor B-1 | ||||
TrEMBL | A0A446UBR1 | 3e-86 | A0A446UBR1_TRITD; Uncharacterized protein | ||||
STRING | Traes_5BL_F80E01D65.1 | 6e-88 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36990.1 | 1e-27 | heat shock factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|