 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Traes_5BL_632EBAD09.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
| Family |
MYB |
| Protein Properties |
Length: 193aa MW: 20973.9 Da PI: 10.0645 |
| Description |
MYB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Traes_5BL_632EBAD09.1 | genome | IWGSC | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 54.9 | 2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+ lv +++++G+g+W++++ g+ R+ k+c++rw +yl
Traes_5BL_632EBAD09.1 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
79********************************************97 PP
|
| 2 | Myb_DNA-binding | 48.7 | 1.8e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++ +E++l+v++ ++lG++ W++Ia++++ Rt++++k++w+++l
Traes_5BL_632EBAD09.1 67 RGNFNDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
899*******************.*********.************996 PP
|
| Sequence ? help Back to Top |
| Protein Sequence Length: 193 aa
Download sequence Send
to blast |
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY 60
LRPGIKRGNF NDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ 120
DAGGNDGGSE GAGAAGVGGG VAKAAAPKGQ WERRLQTDIH TARQALRDAL SLEPSQPAAL 180
AAPALPTPPG SVT
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1gv2_A | 4e-26 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
| 1h8a_C | 7e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
| 1mse_C | 4e-26 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| 1msf_C | 4e-26 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:20149112, ECO:0000269|PubMed:21398568, ECO:0000269|PubMed:23404903, ECO:0000269|PubMed:25616734, ECO:0000269|PubMed:25869652, ECO:0000269|PubMed:25912720, ECO:0000269|PubMed:26725725, ECO:0000269|PubMed:27577115}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269|PubMed:10226370, ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:25912720}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | JF951914 | 0.0 | JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds. |
| Publications
? help Back to Top |
- Geri C,Cecchini E,Giannakou ME,Covey SN,Milner JJ
Altered patterns of gene expression in Arabidopsis elicited by cauliflower mosaic virus (CaMV) infection and by a CaMV gene VI transgene.
Mol. Plant Microbe Interact., 1999. 12(5): p. 377-84
[PMID:10226370] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
Mol. Biol. Evol., 2006. 23(2): p. 469-78
[PMID:16280546] - Brenchley R, et al.
Analysis of the bread wheat genome using whole-genome shotgun sequencing.
Nature, 2012. 491(7426): p. 705-10
[PMID:23192148] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Lee HG,Seo PJ
The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis.
Plant J., 2015. 82(6): p. 962-77
[PMID:25912720] - Lee HG,Mas P,Seo PJ
MYB96 shapes the circadian gating of ABA signaling in Arabidopsis.
Sci Rep, 2016. 6: p. 17754
[PMID:26725725] - Cui F, et al.
Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
Mol Plant, 2016. 9(6): p. 926-38
[PMID:27060495] - Lee HG,Choi YR,Seo PJ
Increased STM expression is associated with drought tolerance in Arabidopsis.
J. Plant Physiol., 2016. 201: p. 79-84
[PMID:27448723] - Lee SB,Kim HU,Suh MC
MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.
Plant Cell Physiol., 2016. 57(11): p. 2300-2311
[PMID:27577115] - Lee HG,Seo PJ
The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96.
Nat Commun, 2016. 7: p. 12525
[PMID:27615387] - Li P, et al.
The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses.
Physiol Plant, 2017. 159(4): p. 416-432
[PMID:27747895] - Lee HG,Kim J,Suh MC,Seo PJ
The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.
Plant Cell Physiol., 2017. 58(7): p. 1249-1259
[PMID:28838126] - Lee HG,Kim H,Suh MC,Kim HU,Seo PJ
The MYB96 Transcription Factor Regulates Triacylglycerol Accumulation by Activating DGAT1 and PDAT1 Expression in Arabidopsis Seeds.
Plant Cell Physiol., 2018. 59(7): p. 1432-1442
[PMID:29660088] - Lee HG,Seo PJ
MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis.
Nat Commun, 2019. 10(1): p. 1713
[PMID:30979883]
|
