PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5BL_6054E8EC9.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 94aa MW: 9841.97 Da PI: 7.3403 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 94 | 1.2e-29 | 28 | 81 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 v+YkeC++NhAa +Gg+avDGC+Efm+s + a+al CaACgCHR+FH+reve Traes_5BL_6054E8EC9.1 28 VVHYKECQRNHAAGIGGYAVDGCREFMASAP--AGAEALLCAACGCHRSFHKREVE 81 689*************************944..459*****************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-11 | 27 | 92 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.8E-26 | 29 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.3E-23 | 30 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.151 | 31 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MGPQQDRSAS KALANGTAVA PERKDGKVVH YKECQRNHAA GIGGYAVDGC REFMASAPAG 60 AEALLCAACG CHRSFHKREV EAVDCDCSSD TSGR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK360421 | 1e-146 | AK360421.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1117M15. | |||
GenBank | AK361357 | 1e-146 | AK361357.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138M11. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020160851.1 | 1e-63 | mini zinc finger protein 1-like | ||||
Swissprot | B8BIU8 | 2e-32 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
Swissprot | Q2RB28 | 2e-32 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
TrEMBL | A0A446U3C7 | 3e-62 | A0A446U3C7_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453KBU4 | 3e-62 | A0A453KBU4_AEGTS; Uncharacterized protein | ||||
TrEMBL | F2D959 | 3e-62 | F2D959_HORVV; Predicted protein | ||||
TrEMBL | W5FC48 | 3e-62 | W5FC48_WHEAT; Uncharacterized protein | ||||
STRING | Traes_5BL_6054E8EC9.1 | 5e-63 | (Triticum aestivum) | ||||
STRING | Traes_5DL_1F0881CE1.1 | 5e-63 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 2e-17 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|