PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 207aa MW: 23798.5 Da PI: 6.8798

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5AS_D9A4C1AB0.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.4	6.6e-18	23	66	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++ Traes_5AS_D9A4C1AB0.2 23 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 66 89******************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	7.102	1	17	IPR017930	Myb domain
SuperFamily	SSF46689	4.6E-22	3	77	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	7.5E-11	3	29	IPR009057	Homeodomain-like
PROSITE profile	PS51294	23.86	18	72	IPR017930	Myb domain
SMART	SM00717	1.2E-15	22	70	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-16	23	66	IPR001005	SANT/Myb domain
CDD	cd00167	1.57E-11	25	66	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.6E-20	30	67	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 207 aa Download sequence Send to blast
GLKRTGKSCR LRWLNYLRPD VKRGNFTADE QLLILDLHSR WGNRWSKIAQ HLPGRTDNEI 60 KNYWRTRVQK HAKQLNCDAN STKFKDAMKY LWMPRLADHH LQQASTVGDH LVPGPPTAYM 120 ESSGMVTSSS DSFASESYDG ARCANASVGE MIHSGDWVQE QNQGFWPETN QNFQLQDSEL 180 SGWVQGFSES DSLAENFWSL EDIWKMQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-17	4	70	40	106	B-MYB
1gv2_A	2e-17	4	70	37	103	MYB PROTO-ONCOGENE PROTEIN
1mse_C	2e-17	4	70	37	103	C-Myb DNA-Binding Domain
1msf_C	2e-17	4	70	37	103	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269\|PubMed:11310740}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269\|PubMed:11310740}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK360551	0.0	AK360551.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1120I18.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020162380.1	1e-141	myb-related protein 340-like
Swissprot	Q2QZJ8	3e-81	JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBL	A0A1D5YTG3	1e-154	A0A1D5YTG3_WHEAT; MYB transcription factor 79
TrEMBL	A0A446SSE0	1e-154	A0A446SSE0_TRITD; Uncharacterized protein
TrEMBL	A0A446SSN2	1e-155	A0A446SSN2_TRITD; Uncharacterized protein
TrEMBL	M8AKK0	1e-155	M8AKK0_TRIUA; Transcription factor MYB21
STRING	TRIUR3_32110-P1	1e-155	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP198	38	330

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G48000.1	4e-56	myb domain protein 112

Publications ? help Back to Top
Ahn IP,Kim S,Kang S,Suh SC,Lee YH Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct. Phytopathology, 2005. 95(11): p. 1248-55 [PMID:18943354] Campos-Soriano L,García-Martínez J,San Segundo B The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection. Mol. Plant Pathol., 2012. 13(6): p. 579-92 [PMID:22212404] Yokotani N, et al. Role of the rice transcription factor JAmyb in abiotic stress response. J. Plant Res., 2013. 126(1): p. 131-9 [PMID:22847900] Wang D, et al. Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response. Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007 [PMID:26740780] Fred AK,Kiswara G,Yi G,Kim KM Screening Rice Cultivars for Resistance to Bacterial Leaf Blight. J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45 [PMID:26869604]