PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_5AL_F013240B3.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 153aa MW: 17642.4 Da PI: 10.9962

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5AL_F013240B3.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	42.7	1.2e-13	15	70	5	60
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 kr rr NR++A +s +RK ++i eLe kv++L++e + L ++++ kk a+l Traes_5AL_F013240B3.1 15 KRVRRILNNRLSAAKSKERKAKYIVELEGKVQVLQGETMNLSAQVKMVKKGQARLS 70 899**********************************************9888776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.9E-10	11	75	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.599	13	64	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.2E-11	15	69	No hit	No description
Pfam	PF00170	6.1E-11	15	69	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.88E-11	15	69	No hit	No description
CDD	cd14703	2.67E-13	16	67	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
MDSEHLAQIV LTDPKRVRRI LNNRLSAAKS KERKAKYIVE LEGKVQVLQG ETMNLSAQVK 60 MVKKGQARLS IHNHEMRIRL QALEEQAQLK KALNEALHAE VERLNLVVAE ASNPHMPNSS 120 EQRMSSQMIQ LHQLQILRQP SQLQQGQQRQ RNF

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269\|PubMed:14704272}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020180724.1	1e-101	transcription factor RF2a-like
Swissprot	Q6S4P4	7e-33	RF2B_ORYSJ; Transcription factor RF2b
TrEMBL	A0A446T9D6	1e-102	A0A446T9D6_TRITD; Uncharacterized protein
STRING	Traes_5AL_F013240B3.1	1e-104	(Triticum aestivum)
STRING	TRIUR3_16337-P1	1e-103	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP14870	18	20

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38900.3	2e-35	bZIP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Dai S,Zhang Z,Bick J,Beachy RN Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus. J. Gen. Virol., 2006. 87(Pt 3): p. 715-22 [PMID:16476995] Liu Y,Dai S,Beachy RN Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription. Biochem. J., 2007. 405(2): p. 243-9 [PMID:17371296] Dai S, et al. Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6 [PMID:19104064] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]