![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5AL_F013240B3.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 153aa MW: 17642.4 Da PI: 10.9962 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.7 | 1.2e-13 | 15 | 70 | 5 | 60 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 kr rr NR++A +s +RK ++i eLe kv++L++e + L ++++ kk a+l Traes_5AL_F013240B3.1 15 KRVRRILNNRLSAAKSKERKAKYIVELEGKVQVLQGETMNLSAQVKMVKKGQARLS 70 899**********************************************9888776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.9E-10 | 11 | 75 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.599 | 13 | 64 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.2E-11 | 15 | 69 | No hit | No description |
Pfam | PF00170 | 6.1E-11 | 15 | 69 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.88E-11 | 15 | 69 | No hit | No description |
CDD | cd14703 | 2.67E-13 | 16 | 67 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MDSEHLAQIV LTDPKRVRRI LNNRLSAAKS KERKAKYIVE LEGKVQVLQG ETMNLSAQVK 60 MVKKGQARLS IHNHEMRIRL QALEEQAQLK KALNEALHAE VERLNLVVAE ASNPHMPNSS 120 EQRMSSQMIQ LHQLQILRQP SQLQQGQQRQ RNF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020180724.1 | 1e-101 | transcription factor RF2a-like | ||||
Swissprot | Q6S4P4 | 7e-33 | RF2B_ORYSJ; Transcription factor RF2b | ||||
TrEMBL | A0A446T9D6 | 1e-102 | A0A446T9D6_TRITD; Uncharacterized protein | ||||
STRING | Traes_5AL_F013240B3.1 | 1e-104 | (Triticum aestivum) | ||||
STRING | TRIUR3_16337-P1 | 1e-103 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP14870 | 18 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38900.3 | 2e-35 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|