PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5AL_1EA22121D.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 132aa MW: 15275.5 Da PI: 9.7292 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 82.3 | 5.2e-26 | 32 | 72 | 2 | 42 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtk 42 +e++++cprC+s ntkfCyynnys+sqPryfCkaCrryWt+ Traes_5AL_1EA22121D.1 32 PEQKVECPRCKSGNTKFCYYNNYSMSQPRYFCKACRRYWTH 72 7899************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-19 | 30 | 72 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 7.6E-22 | 34 | 72 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 20.654 | 36 | 90 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MEEVFPSNSK SKAGQMAGEA TAAAEKKPRP KPEQKVECPR CKSGNTKFCY YNNYSMSQPR 60 YFCKACRRYW THXXXXXXXX XXXXPQAQAP GDLRRPQARR GLLVRTHGCH AALDLHRDEL 120 CQRPPNIYVC WF |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KX058135 | 1e-115 | KX058135.1 Triticum aestivum prolamin binding factor (Dof) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020190796.1 | 9e-45 | dof zinc finger protein DOF3.2-like | ||||
TrEMBL | A0A446SYX6 | 2e-45 | A0A446SYX6_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446U4H0 | 3e-45 | A0A446U4H0_TRITD; Uncharacterized protein | ||||
TrEMBL | W5FAJ7 | 3e-45 | W5FAJ7_WHEAT; Prolamin binding factor | ||||
STRING | Traes_5AL_1EA22121D.1 | 8e-84 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP140 | 37 | 367 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61850.3 | 9e-21 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|