PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4DS_A980F512E.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 153aa MW: 17154 Da PI: 8.3654 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 60.4 | 4.8e-19 | 37 | 94 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++++ l+ +isw g+sfvv+++++fa +vL + Fkh nf+SFvRQLn+Y Traes_4DS_A980F512E.4 37 FLSKTYDLVSEPWLDGVISWGPAGKSFVVWNPSTFALDVLLHNFKH-NFSSFVRQLNTY 94 9********************************************9.7**********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00415 | 4.0E-16 | 33 | 120 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 1.0E-19 | 34 | 94 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 6.39E-17 | 35 | 94 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 2.1E-15 | 37 | 94 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.3E-5 | 37 | 60 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.3E-5 | 87 | 99 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
SYYSEIYISC SSPDPAAARA GGALRAAAAL VVLRPPFLSK TYDLVSEPWL DGVISWGPAG 60 KSFVVWNPST FALDVLLHNF KHNFSSFVRQ LNTYVRIVSL SNPLFFFQTI TGLLFMPPSS 120 TRETLCFCLV SSTLFRMLCF YFCSFWFLLL CSA |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM446028 | 3e-66 | HM446028.1 Hordeum vulgare subsp. vulgare heat shock factor A3 (HsfA3) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020146599.1 | 3e-31 | heat stress transcription factor A-3-like | ||||
TrEMBL | M8B8C7 | 1e-59 | M8B8C7_AEGTA; Uncharacterized protein | ||||
STRING | Traes_4DS_A980F512E.4 | 1e-107 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP49723 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17750.1 | 3e-20 | heat shock factor 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|